Dataset for protein BCL-2-like of organism Tarsius syrichta

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                    . :         
ma-p-sapdtr-lvadfvgyklrqkgy------------------------------------vcgagpgeg--------
--t-a------a-----l---------swsqfsdveenrteasegtesemetpsavngnpswk---srsvnpatghsssl
  d lmsrtn e lv y-s casp                                    m hrvdppaqk         
     eeqsa        e                                            lt l  p          

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                        * *   ..: :     **:  :   .: : :: .. :  ***:*::. *       
-----ppadplhqamraagdefetRfRrtfsdlasqlhvtPGsayqsftqvvdelfrggvn--WGRlVaffvF-------
darev-a-------l--------r y qrvpsmtah----  trqdrtermsnavlqdspdls   i tlvs agtller
     r-ssavkav- sta  lsl w pphfftafviy    v l a  a    s  r      v    t        
     i ma ea    e      a l  a         d                                         

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*  * . . :. :          *..   .:.: *. .*      *:: .***                           
GgaLcaesvnkemqpl-------VsrvqtwmvayLntrLap----WiqssGGWd-tfvelygnnaaeesrklqe--n---
 al pvggqdrgfevrrkkeegd gqiaerlatl edh edrhra lhdn   ele----------a-a--g--rf-eve
       q   r          dcq      sa   g       aq   a -atkarvrgml- -er-r lq    
                                                         ia   de e      k       

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------rwfltgmvvagvvl---------------------------------------
kqmnmspppgnwgsvimsieekmeada-------t---a--teleahfhgcgsvnrvtilcdkfsghpkgfayiefsdke
           aap              tvyv n-dy -tve                                      
                            si   a al  la                                       

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                            :  :
--------------------------------------------------------------------------vgslfs
svrtslaldeslfrgrqikvipkrtnrpgisttdrgfpraryrarttnynssrsrgysvfnstprprvywrrlrltafya
                                                       ffcg f r lgltfrg apaq wv 
                                                                                

       410      
....:....|....:.
                
rk--------------
sylamafiyffwtrll
pl              
c               
© 1998-2020Legal notice