Dataset for protein BCL-2-like of organism Mesocricetus auratus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
         .* *:.*:: :   :                                                .    .. 
matpasapdtRaLvaDfvgyklrqkgy-----------------------------------------vcgagpgegpaa
-----rvr-n l lv yltfcase---swsqfsdveenrteapegaeseretpsaingnpswhladsp---patphssst
  d lmsqs  e  t   s                                                 avng d  p pl
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.        .    :* ..:::: ...  **.:..      *.  : : *: : :: .*   ****:* :: *..::  :
d--------plhqamRaagdefetrfrrtFSdlaaqlhvtpGsaqqrftQvvdelfqgGp--NWGRlVaffvFggalcae
sarevipmaavkall svaeqiqqqyhff  sfvs----yq tryesme msnavlrd vdl    i llls aativvq
          ea    e      l h  a    tg   i   n v l         p  q           a      s 
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
.  : ::  :  : .       : . *  .   *:  .***                                       
svnkemeplvgqvqd------wmvtyLetrladWihssGGWd--------------------------------------
eqrnrlqvkmsvlascqlivallcnr nrhhrs lqdq   eleaikarvremeeeaeklkelqnevekqmnmspppgna
  d   k kri          a   ld  ep  ean   a                                      
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                            :  : ..             
-----------------------------------------------------------tfvelygs-a--es--l-e--
gpvimsleekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsghpkgfgytvisdnn-vr--rr-r-sn
                                                           e iaff kgsletalp plgl
                                                           a    de aa   a d df

       330       340       350       360       370       380       390
....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                       .              
w----ikt-l-----------------------------------------ttgvayaglvvwgslfs-k
-strq---v-krtnrpgqsttnrwfpraryrarttnynssrsrfysgfnsrsrvrvvrivftvtrwy-s-
frsllvrvip     k ierfd g                           pgamttgararlkaflary
 ag     f                                          lc i l    la     p 
© 1998-2020Legal notice