Dataset for protein Bcl-xL of organism Lonchura striata domestica

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************************.:  . .          
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLstllsrs----------
                                                               gsrscikprtrsvprwr
                                                                 di c clna dca g

        
....:...
        
--------
arglalah
        
© 1998-2020Legal notice