Dataset for protein BCL-2-like of organism Larimichthys crocea

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                              :*  :*   :     :  : . .  .  ..  :*:  .: : .*   .  
-ss-eglsstvtdwlfinswwlllpfi---i eky chklskqgyvwgfddvrdedaanngsi appptlvrr reastg
 an rnrn                                                                        

        90       100       110       120       130       140       150       160
 :   *.                           **  :  *. :: :  *:.:* ::*          :.  :  :.*:
pdtes ph--------------------------  krlpq dphaaihr lre gde erlyqpdftemsrqlylts t

       170       180       190       200       210       220       230       240
 . .* :: :* :                                                                   
aqrr aev-i elfr-----------------------------------------------------------------

       250       260       270       280       290       300       310       320

       330       340       350       360       370       380       390       400
    .  .                         :.:  :*.        : :                            
sigenwfqivtvglyrrqrdsvfscswpsiktvfgmaef g--tviveyvtkk----------ewmteylngplnswiqd
 d v  g dafme fd                i  f a  aasltcga la e mtpqv nia                 

       410       420       430       440         
© 1998-2020Legal notice