Dataset for protein BCL-2-like of organism Equus asinus asinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                                  :                                         .   
                     amhgpgmfqsigm aqagkh t qrr gggeafadieenrtes ltalppmgtfqpqn 
                       gadceappg a  m  ig     e  e d     a d  a  e  eaedelcg i  
                       a  aa g          e                                       

        90       100       110       120       130       140       150       160
pigaegpdvtappsrlrffaptrcasppegmeapaadaimspeeeldgyepepl psswslrtsptvrp-tshsstlpal
                                                       nrktpapllellpg spgpcsggsr
                                                       kp  h ad  fgne agagaadd  
                                                       eg  a                    

       170       180       190       200       210       220       230       240
                                                       . : .. .    :  :     :.  
pst mdpek                                         eia q   d ql hepd dgflrk dlkie
epi  a  e                                         d   e      k f  c ae ha      d
                                                      a                a        

       250       260       270       280       290       300       310       320
     :  *    * .*  ****::::: * . :            :         :.  :      *: .. **     
sdytrlst mnkv sg vt    lmtliv eavvikkllsrrqsvdisryqtisysvatvivtttht lvqsr  et---
d vki nr sdhq q  ip       i e   imaah kpiniqsc gqvkl   fivdf tkrkgp  rkq   ag ta
a qg    a   e   i         a   f      de  a   epl         edn ee  h    e   
                                              n                a        a   

       330       340       350       360       
                          .*     :             
---vsm---srkg-rl-nss-lsv-wf svtvlmaalllvlslfs--
ffhpnfvkkg   qprrkgn a lknl llmgklceiifgkqfyis 
   dedaagf   ee pefg   i a  eafag   cga     gh 
         a       d              a           a  
© 1998-2023Legal notice