Dataset for protein Bfl1 of organism Cricetulus griseus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                *  * :*        :. .:** ... ..    *..*:  **:*  * 
-----------------------------mtdCefMyiHslaedylqyvlkvPTfesapsk----TsrVlqrVAsSvqKe
mitpslsshlwlsclfdwtwqlqsalprt-ma ap lv r------ghapsl  asegdgrgrgg ch maa  a sa r

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                   *  :* *   .*..    . *::::: ::
veknlklylddfdvrsidtartifnqvmekefedgiinwgrivtvfafggvLlkkLaQeqigLdvgaykqvSnfvaefim
--------------------------------------------------s rae k rlra saeerlrq hlltqkvi

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                 :  *: .:                     **
nntaewirqnggw------------------------------------kigFmpryr--------------------PK
-------------viahsqyqnskrisiflsmqdeieteeiikdifkqgedc ikkfefqsnhmdmvrlaspeeisll  

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
:.*  .  : *: .*               : *. :.. *.* . * :*.             : *.*.* :: . ..  
tsWvthqptiGqiwE---------------mlFspqgtrLgRgk-GyyDt-----------kpytLvLpFknqscprv--
sg nifleae dar ealstggldliflpglg dkdanl a edp sf nylkrcvqhqevgdhh a a aeniadqtpv

       330        
....:....|....:...
                  
------------------
dehdmkvdevlyedcpas
© 1998-2020Legal notice