Dataset for protein Bfl1 of organism Cricetulus griseus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
*  ..:  *      *.   :   . ...  ..*:       :      *:  *.. : *.   ::  : *.* :  * :
 acapmlv rghaps ptasegdgrgrggtchv aavaassakrslrae kqr ralsa erlrqshllt k iahs yq

        90       100       110       120       130       140       150       160
 .*.:.::*            :: :::  :*: ..*::.*.                                       
ns risif ------------smqdeiete iikd fkq kivtvfafggvllkklaqeqigldvgaykqvsnfvaefim

       170       180       190       200       210       220       230       240
                                                  *  :    *  . : : .**.         
nntaewirqnggwviahsqyqnskrisiflsmqdeieteeiikdifkqgk vtv---- afggvllkk  q---------

       250       260       270       280       290       300       310       320
              : .*..*. . :  *:. : ::: .:.: .. *: * ::*.   :.   .:  *:.  ::  :.**
-------------eqig dv aykqvsn vaefimnntaewirqng we gfm kfepksgwvtfle igqiwemlfs  

       330       340       350 
..:         *: * ::   : ::..   
atllaredpgsf ng hhlvlpfannsadrt
© 1998-2021Legal notice