Dataset for protein BCL-2-like of organism Cebus capucinus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
m-qs------nrelvadflgyklsqkGygws------------p------------------------------------
-td-prsypdtltqdylwyvlq-r-s---pgqfsdvagsggea-pgaapaprlltdsemetpsaingnpswhladspsvn
 s-tefgaih--a--vmyvs-cipr- tv--gaglgeenrtat ea    ggifstqpghsaqrevprgpvgrvspgapp
 maplatrymqg-ir-kvi- -s-et lscd       pvp s           asekea  gpaa gdeaaatig rll
 aglg qg  fera ngl-l n ycr arl        dt                                       g
 f a        n  ma nh   k p  e                                                   
            l  i   e     g                                                      
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                        .                 ..  ::
---------------------qalraagdeferryrrafsdlasqlhvtpgtayqsfsqvveel--frd--G-vnWGriV
aatghsstpdarevvpmppvh---ktvrvlqkvlfsvtkpcmtavniisidnrrtrverpmntedgyegspliptrpnvl
gtpaaatslpplsgpaadalkatm-es-agvstalftqrtryln----ynfsdvkilttmsdhv  lspe  vi a
 sgpkdlkgmggrpirsavillvvp--t--prlvieswpqpvdrp elmeep qglias eva    q     t      
      a ag    a ptkegee  rta t qknh ff agrsgm dek ad aea m  a            g      
                 r aa    q   d  g    d  e p k         d                         
                         d              a                                       
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
 :: : .                                          :   :                          
affsFggalc------------------vesvnkemqplvs---riaewmatylndh-----------------------
tllaleaiviergplvtgswtkwslqstkkllderievdydtykqvsafvvevivtratgakdtkpmgrsgaasrkalet
piiv v vpl      narskdggfp rapppqrnvsscrg   elqysitar mrq                       
m  e a tmg                  phekei qar ir   psvlllss  enn                       
   y   f a                  l  atg ede  q   n lgi  r  rgt                       
       e                                e          d   e                        
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
           .     **                                                             
--------lrpWiqengGWd------------------------------------------------------------
lrrvgdgvtedhlrssr  -leaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgn
        qge ehqqq  e                                                            
        kat  vaf   g                                                            
        hhn  tk    a                                                            
          a  ed                                                                 
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------------tfvelygvn
vdygataeeleahfhgcgsvnrvtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvdvkaf-------n-
                                                                       nystvtq-s
                                                                       kvtsrrhtr
                                                                       i  aff pl
                                                                       g    c di
                                                                       e       g
                                                                       a       e

       410       420       430       440       450       460       470         
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....
                                                                               
a--e-rkgqe-f-------rwfltgm--------------------------------tvggvv-----llgslfsrk-
-aa-s-----r-nggwrsv-tl-sllqdllltgimekiagpgfpynvvrssiysllnvglaa-iyrkrrt-sl-----l
plrgtvrwrttvdrsfprlly-sl-a                 nvmssn rfhlgfdtrires-gqike-v-ayyqyy 
mkmtp pllsptsfnilncklvr-wv                               smpvsrtakgcarmt-wlpsr 
gge n ekiqlkpa  c ag sfrtt                               alfsnlk     mfapfklpq 
dc  f   hpkca   a  c raamf                                i l k      ka  a gi  
    a   f h          h                                    a   f      i     ah  
                     a                                        c      a      a  
© 1998-2020Legal notice