Dataset for protein Bfl1 of organism Cebus capucinus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETEFEDGIINWG
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***************************************************** :           *    : ::* ..:
RIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWgn-----------W----mtlvEvvgq
                                                     ekgfvkkfepksg hslmlmfl stak

       170  
....:....|..
    ::*     
kkrmmsL-----
icekla lkqyy
© 1998-2020Legal notice