Dataset for protein Mcl-1 of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
------------mfglkrnaviglnl------------------rll---------------------------------
gmlpifseeeed--------------ycggaglgqgsgasspgg---aagkeatarrevgggeagtviggsagpsppatl
            elywqslei sry                    eq                                 

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
apdarrvarpspigaegpdvtatptrllffaptrlasppeemespisdaimspeeeldgcepdplgkrpavrplpllvge
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         ******.**** **:*********.*******.******
-------------------eeeedely-qsleiis-ylreqATGAKDvKPLGgSGtTSRKALETLrRVGDGVQrNHETAF
asnnspgsdgslpstpppc--------w-------r-----      a    r  a         h       h      
                 ma        r       q                                            

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****.*********************** ********************:******************************
QGMLrKLDIKNEDDVKSLSRVMVHVFSDrVTNWGRIVTLISFGAFVAKHlKSINQESCIEPLAESITDVLVRSKRDWIVK
    q                       g                    f                              
                                                                                

       330       340       350       360  
....:....|....:....|....:....|....:....|..
:*****************************************
qRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
e                                         
                                          
© 1998-2022Legal notice