Dataset for protein Bcl-xL of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
****************************                    .  . ... . :*     **:********** 
MSQSNRELVVDFLSYKLSQKGYSWSQFS--------------sdmgtpsaingnpswhlaD-----SPtVNGATGHSRSs
                            dveenrteapegtevryenkqwrsetaegres metpn  a          l
                                          --- m et                            

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***::***::********.:**:*.*..:**** ***.****** ******:****** *:**.:******.*::*::*:
DARkvIPMttVKQALREAsnEFkLrYrrtFSDLtSQLrITPGTAyQSFEQVvNELFRDrVnWGrvVAFFSFsGtlCvkSv
   em   aa        gd  e w qqa    m   h      c      i      g k  hi      g ai me i
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
***::****.::*  *****:**:**************** .*:: **.**** **  :       : .:.    :::. 
DKEmqVLVSrvtTwmATYLNnHLkPWIQENGGWDTFVELYgsNttnESrKGQErFNrwfltgmt--vagvvllgslfsrk
   ih    qia st     d  e                en aaa  q    c  siytlaavagltnlisntkiytkl
                                                        c-ws ttrlw f if ikh    q

       250       
....:....|....:..
                 
-----------------
dqrctlpyyvghsgsdr
psn   ehls ryatll
© 1998-2022Legal notice