Dataset for protein Bfl1 of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------mekefe
mtdtefgyvhglaedylkyvlqiqqpgskpsktsrvlqdvassvqdevertlkqcldkfdvvsvdtartifnqv------

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
      .  *:: . :  *  :*  .  * . :     *.::*:               .                    
dgivnwgriVtifafegiLtkkLlgkciAsdmdmckdiSffvAefitentgewikqnggw--------------------
-----maaa avsgakrs rae kqrlr lsaeerlrq hll q---------------kvfthneyqkskrvsiflsmp

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                :. *: .:: :*..: :::::.                                          
----------------ktgFvpryqtqSnwmtmvkvts------------------------------------------
deieteeiikdifrqgenc ikkfelk ghldflelagpeeiallprtswniqqpgedevleealstggldlifvpglgf

       250       260       270       280       290       300 
....:....|....:....|....:....|....:....|....:....|....:....|.
 * .: * * * **                                               
-KqsntLgRlKqYY-----------------------------------------------
d icer c g g  daylkrclqsqdvkpytlalafkeqiclqvpvnendvkvdevlyeds
© 1998-2020Legal notice