Dataset for protein Bcl-2 of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MAHAGGTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPPGAAPAPGILSSQPGRTPAPSRTSPPPPPAAAAGPAPSPVP
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
************************************* *******************************:.   * :*  
PVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARgRFATVVEELFRDGVNWGRIVAFFEFGGVMCVesvnrEmsPlv
                                     e                               ddrvp pa --

       170       180       190       200       210       220         
....:....|....:....|....:....|....:....|....:....|....:....|....:....
             ** .  .  *  .:  *    :  *: .  *    .: .  : *  :         
dsialwmteylnrHLhtwiqdnGgwdafvElygpsmrPlfdfsWlslkallslalvGacitlgaylghk
------------a  dpgqrrl rcssgc serdtsv vrsew ----gvagprvk rpve--------
© 1998-2022Legal notice