Dataset for protein BCL-2-like of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
mgtvlfsghplqgwksstsawnvrdllemlnllqgfmrpsrllftasrvrspawplmpswpcsswppaalffpelwlfps
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
---------------------------------------------------------------matpasapdtralvadf
lrpspaplsgrisgphhhpapgppsrppfllppsfppflpvmfglkrnaviglnlycggdslm-m---msqsnaeaavgy
                                         slppssctrkqpdpgssaagahs-agpfrerlygqlmki
                                                          ltp gqhvdeegyggwrisler
                                                              ragsegtedeamwr-g--
                                                               ekcata-aa-hl i-tv
                                                                 ef -f--v    eak
                                                                    d iy        
                                                                      gv        
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
vgyklrq-------------------------------------------------------------------------
lsfcgsevgggeagtviggsagpsppatlapdarrvarpspigaegpdvtatptrllffaptrlasppeemespisdaim
ierya-r                                                                         
ghgprql                                                                         
-a---i-                                                                         
s-tv  i                                                                         
fkae                                                                            
e  a                                                                            
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------------------------------------------kgyvc-----
speeeldgcepdplgkrpavrplpllvgeasnnspgsdgslpstpppaeeeedelyrqsleiisqylreqrtgawsqfsv
                                                                      ahtsk     
                                                                      p-lpp     
                                                                      -k-la     
                                                                      take-     
                                                                        e-v     
                                                                          l     
                                                                                
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--gag--pgegpaa--------------------------------------------------dplhqalraagde---
rydvkplgsspetsrpsdmitssqpgrtpawsrtssptvngatghsrssdvrpvipmpdeietetkaketmhrvsagrnv
  p--gartttapgaeapgelpfitnnngspilqnpgpppthneyqkplraskmvsl       rlvlv-agqqetn   
  -rpeeaaantgwtq hlvaq aieg ae hkadg w fa aagpa kp piflh        var--inqigknd   
  qnldwsrpesephl ffl e               k              e           g--dygf eeaec   
   mernqqmdmsldi                     a                          etisdv  l  ss   
   kcqhldga rk                                                  sig r   d       
     i i    k                                                   a t             
            c                                                                   
                                                                                

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
  .                                                 *                           
--fetrfrrtfsdl-------aaqlhvtpgsaqqr-ftqvsdelfqgg-pnwGrlvaffvfgaalca-------------
lpvqrnyetarqemdmvklaslskmdiknetdvksilsremp-v-rdrvvst piatlis-agfvakhppqttrrqekrd
  lyp-hq-h-vgc       vrep-l---d-anp qlprvvh-ls-aitkp hv-sivtps-s-lvrllg         
   slwc-q-snh        tqrir-lsr-swgi pedgdnke -e  lg  g-d---- es-m-ekf           
   khe- lqleq        sl fepe fperet  rt ie   e          l  e   vap-             
   id v  d a         pe  a v v ter   q  e    p             a   titm             
           k         md         c    a  a                      g  g             
                                y    n                         i                
                                                                                
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-esvnke--meplv----------ewmvayletrladwihssggwd----------------------------------
dkgisrdscisv-aegdpgdgqvq-s--dvfvrhkrp-lvknr---sqtseaemvhevffgeilsncdsapsspvpeele
 d--dq-  crlc-      saitt-it---nesh-al-qe--yya                                ft
 -qe--   --- k      ds eallatqi----n-ggr-q rcs                                  
 ndree   ehg         r adpvclg cnqskr qmgk   f                                  
  c vs   pqm         d slft ef dkntht  -ae   e                                  
    ap    d             f      td  ge  ktl                                      
          a                     a  e    r                                       
                                   d    q                                       
                                        d                                       

       570       580       590       600       610       620       630       640
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
aikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnr
 lyg  dgal   rr r                  was              tvlt a al  lvtv             
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

       650       660       670       680       690       700       710       720
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------gfveffyr-rt----rsrsrf
vtilcdkfsghpkgfayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdr--prar--a--tnyn--vll-
                                                          nty----hvsdleggisn---a
                                                           agcllyeqetqpswekqqvwt
                                                           s lkrcssnqdvesytglear
                                                               selttfpnkpq lapv 
                                                               k gp saa  r  gwc 
                                                                 rn m           
                                                                 pl i           
                                                                  d a           

       730       740       750       760
....:....|....:....|....:....|....:....|
                                        
fsgfnsrprgrvyrsk------------------------
y--y-t--avaffairlratlyyspyqrcpyyvghsgsdr
-lwva-ai-ilanllggstvswsksd   cvtl aylghk
nas-wgvgiaiyvwvianek fedl     ie        
keqwtlqvvlnltngvvly    rk               
sriil lapeggpd lsd                      
dfa c kmt telv  qy                      
  e   gkg  sc    a                      
        c   a                           
                                        
© 1998-2021Legal notice