Dataset for protein BCL-2-like of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
maaaaaaaaaagaaggrgsvsgwnvydllemlnqlsgpgrrrhlvpgaggeagegapggagdygngleseeleppellle
  mgtvlfsghplqlwksatial lrcggag glgq fsspsrrllt srvrtprwevmpswpctvwppsagpsepaw f
           mfg k n                   am  gg  fa  k  saar l g ea ssigga  ff   t a
                                                                                
                                                                                
                                                                                
                                                                                
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-------------------------------------------------------------------------dtralva
peprpepepepprprgppgapgpgpgsgapptrppspppfmpvslspssmgnqeeeegsgldslmmatpasap-------
 slervaressigisa hvtat trplrpafllla f eelespipdaictrkqplpecsatpahsmvdpmsqsnaeilm
 da  s a l g ae  dhh a   l ff                     spe  dd  ep   rahaggfrerlprkrv
                                                                 lgkr tgypfgl  n
                                                                      avrm     g
                                                                                
                                                                                
                                                                                

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
dfvgyklrqkgyvcgagp-----------------------------------gegpaadplhqa---------------
------------------mceeeedelywqplgiispylresatgakdakplg-s----raa---rssdarpvipmttvk
kylsfcasep tswsqpsvrydageartepsgeapadgitsqqpnrtpvpsrts-patstk-aevaplpvpkmvhlkasr
evienspysr spvpgf pa gvpqwgaat eate rmelpl i mnatwhgyvp tvng-tlhtlqiqq gsk sa   
aashln gcg aeaetd     nk nisrn swrs q g l    g  sef ard lpe-yegas      e        
   n     d  lp        m  h  ga   hl                  nh  ipa  kgp               
            gl                                       d         y                
                                                                                
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--lraagdefetrfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqdg-pnwgrivaffvfgaalca----------esvn
qam--v----q---------m-----i--et---s--r-m----rg-vv----l-tlis--gsvakrppqttrrqeklkd
vl-hr-sagv-rnyetalqg-lskrr-kv--dvk-ls-l-vhv --ri-smahva----aa-f---          h--s
  qdh anriseahqnvkplyrrcddhrnfdvrrmaqt veke sp  tk  a- sivt sr-mlv          -rd-
    e  sdqklwn qd ae tqf vls dl agi e  ln   d        a  vse e vite          dflg
    q   v dhve  l  c sk         ct  a  i    e             a k t rm           div
    v                m          y   n                     g   i               rq
                     d                                                          
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
kemep---lvgqvqewmvayletrlrdwihsnggw----------------------------------------v----
inqssdmd-c--la-s-a----rh-a-----s---vfthneyqkskrvsiflsmpdeieteeiikdieleaikaf-reye
--ia-saec-ep--t-ltdvfve-k-pglvk-rrkfsqts aemvhe ffgeilsncdsapsspvpefrqgkdtrielmq
dg--v   dislivali-tqin-shka qqeq  c                                lh  mtcggprfg
rcvhr   mrrrqsffvcef cnntge  mqe                                       essackser
plrql   e kd tl t q  td  ht  kal                                        rg  dk  
  p       ls  h       a  e   rt                                         n       
          d              d    r                                                 
                              d                                                 

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
eeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcgsvnrvtilcdkfsg
snstnesrkgqpsfneiyltartvwniqlpgntklyskllstgplylghvpslrfdkqsnrlgrgkgyydaylemeplv 
lqtnhmdqvkvarpeswwtllavsglvnqvsedqvletqvqdcgvdvifsg dgvaficev callqaes nk       
ttmgwftmtfltlrsrsav gmgaagtv l ra qrfrk   elit  pyw rl   f  t   a c             
ps ar rf esdgadflh   kallspr k a   f       cfq  anl hk                          
nk  a     r c a  f   g    la                 e                                  
d                         a                                                     
                                                                                

       490       500       510       520       530       540       550       560
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------dgf------r-regnw-svr--f-------
hpkgfmvayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttd---pefryv-a-----n--lsr-yggfnsg
qvaew    v trlvdwlhs ggwa f                  talygr alrafr ellttsyrns-tvlasavgvr
  q      l  fha di                                   vleah qdfqpgiarqpla tlvaalq
  d                                                  c   s ksclq qevk vw f   ke 
                                                         p lrip   d   yt        
                                                                                
                                                                                
                                                                                

       570       580  
....:....|....:....|..
                      
-----g--y-sr----------
arvtv-rv-r--iriyswyspy
pllq lafflikaiatflikls
ic   plawagikvdev  edl
      vyetag          
      sn ndv          
                      
                      
                      
© 1998-2020Legal notice