Dataset for protein BCL-2-like of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                gamaaaaaaahgaa wkglaaakearall mgggea tvipssalftpsrvrsedwrrvpswsp
                    tvlf   plq   s                   fm ggr g s patla a  lm rppc

        90       100       110       120       130       140       150       160
sswpppdvtftptw lfslrtslaspsgemss ishaims perpdfce dpfgkfla rll llctrkspnspggatpa
i a gaa fap  r f fap r  pl e ieg hhd a   e el                      eaqndpg  dg  

       170       180       190       200       210       220       230       240
hsmvdpms-s-d-iymq----issyrresa       draeartapgetrtspgelpfitnnngspilqnpgpppthney
rahagmfrqrearrl-ksisivrqllkkqv       a-ddwgsetmsgaepdlvaq aieg ae hkadg w fa aag
petpfgtgyevwgaawtvshaegiita l-       ev--naamneqdtviefl e               k       
  ke tceiy m  iraifk     q  el       -nprhsdge cahskh                   a       
     eefgv h   e   a         k       qmlq l  d  wdq f                           
      d                               kki i  a  p l                             
      a                                c        l i                             

       250       260       270       280       290       300       310       320
qkplraskmvsl       rstk-t-hq-lr-----he--n---       ---ydl-- ed-----s-m-----sed -
pa kp piflh        p-aldifq-gsth alw--eqsrnv       tpli--cr --rrelv-tgvqre --r r
       e           etvprv  e knd saei qdlnhc       srefarls fhswniqep ank  e   a
                   siis    d asc kp v l  ae        pq    v  d  cg  q  ie   d   i
                   aa          s ih      kq        me          yt  n  e         
                                  d                 d                           

       330       340       350       360       370       380       390       400
t-t hva----pa-fvakkll       krk-inqssciep-atsitdv-ves---llq---yy                
-k  g-dsivt s smlv          hldsdgvhvdcslivallatqin--hnagg-eq rc                
l      l  e e vite          gfivrsiqrm rs tlfvclg cnqskr qrgk                   
          a   t  m          dkrip pmd  kr sf t ef dkntht  mae                   
              i              dc a da   dd         td  ge  ktl                   
                                                   a  e    r                    
                                                      d    q                    

       410       420       430       440       450       460       470       480
                lhq mr agd f    trfrrtfsdlaa lhvt g          aqqrftqvsdelfq gpnw

       490       500       510       520       530       540       550       560
 rlvaff  v gaalcaes nkemeplv qvaew    l trladwihs ggwa f                  talygs
                               q                                              en

       570       580       590       600       610       620 
aylllyhqlteesgatnltlatga---g--anlnlfwaa-aritfsikllcvtl aylghk
sgckeaeseq-pesekqqewtnawytgvgllggvnaktgiviaskldqrc ie        
    rcstnfq-----gavarkeqwltqvv aetdyigngk ledy   s           
    selp--dvkpy - pc -riic amp lspvivvdtc fkrk               
    k gntspn  q l    sfs   lkt   as lste    q                
      pl mks  r f    d       g    k cerl                     
       d iaa  l                                              
© 1998-2021Legal notice