Dataset for protein Bcl-w of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80

        90       100       110       120       130       140       150       160
                                                               **:.*:*. : . ... 
lrpspaplsgrisgphhhpapgppsrppfllppsfppflpvslppssctrkqpdpgsgltpar  aa a aaaagaaggr

       170       180       190       200       210       220       230       240
 .   *..  * ***  .***.....   .    .:*:*.      .:*  :    * . ::     :     *.*. * 
gsgpg rrhl p   gea   apggagdygnglese l p------ee llepepe epeeepprprap---p a gp p

       250       260       270       280       290       300       310       320
       *:.  .:. ::* . **      * :::                                             
------- sgapgnqeee esg  egdpgd aiedp-------------------asqtseaemvhevffgeilsncdsa

       330       340       350       360       370       380       390       400
       *: *: .      *** .*.*               ** ..*            *:: .* *  ** .     
psspvpe ft lyg--dgal   rr r ---------------  was ------------ tvlt a al  lvtv---

       410       420       430       440       450       460       470       480

       490       500       510      
                   * .: .           
------------------- affagraratswyspy
© 1998-2022Legal notice