Dataset for protein Bcl-w of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------------------------------------------------------------
maaaaaaaaaagaaggrgstsawnvrdllemlnllqgpgrrrhlvpgaggeagegapggagdygngleseelepeellle
  mgtvlfsghplq wks                   fm psr lft srvrspaw lmpswpcsswppaa ffp  w f

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-----------------------------------------------------------------matpasapdtralva
pepepepeeepprprappgapgpgpgsgapfllppsfppflpvslppsscgnqeeeeesgltpar---------------
 slr s aplsg isg hhh a   p rp                     trkqpdpg                      

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
               ..**:*.  **                                                      
dfvgyklrqkgyvcgagPGeGpaaDPlhqamraagdefetrfrrtfsdlaaqlhvtpgsaqqrftqvsdelfqggpnwgr
-------------vegd  d aie  ------------------------------------------------------
                                                                                

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
lvaffvfgaalcaesvnkemeplvgqvqewmvayletrladwihssggw-------------------------------
-------------------------------------------------fsqtseaemvhevffgeilsncdsapsspvp
                                                                                

       330       340       350       360       370       380       390       400
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
-eleaikarvremeeeaeklkelqnevekqmnmspppgnagpvimsieekmeadarsiyvgnvdygataeeleahfhgcg
e-------------------------------------------------------------------------------
 lhq mr agd f    trfrrtfsdlaa lhvt g          aqqrftqvsdelfq gpnw rlvaff  v gaal

       410       420       430       440       450       460       470       480
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                  :                                         :  . *      * *  *: 
svnrvtilcdkfsghpkgF--ayiefsdkesvrtslaldeslfrgrqikvipkrtnrpgisttdrGfpraryRaRttNyn
----------------aewmv--------------------------------------talygd aleear l eg wa
caes nkemeplv qvq      l trladwihs ggwa f                                       

       490       500       510     
....:....|....:....|....:....|....:
* *: : ...   .    * .: .           
SsRsrfysgfnsrpr---Grvyrsk----------
 v tvltgavalgalvtv affagraratswyspy
                        g          
© 1998-2020Legal notice