Dataset for protein BCL-2-like of organism Anser cygnoid

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                         .          .                         : 
---------------------------------ee-a----alysaraylaavltps------------g--g---a-ev
mahpgrrsysnrelvlkyvsyklsqrgyswsql--t-pfyyvyrprqppvqyavq--rswprprtsvvp-tr-srs-sds
      mggd  di idfih     k  d aagmdreeepttdfl eddtdg gngrphrhpllsrprneppvhldsr p
                                   e danr  aa a a     e  ggagagalqnhe aa gaa l a

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
            .  .**  .. .  .    :  :  .: :.       .   *    * **  ****::::: **. : 
ppg----prstvvrqaLRragdefsrryerafsqmlsqlhitpvtayqsf-vqVvnelFrDGv-NWGRvvtffsFGgvlc
hlieglrvarrrallv  qvassvqlqtrldlrpltrrielksgevrkrvfng mehv s  nt    imalit  alvt
 ga    a qpk hht  ni  gllekhqe  qgfsgk d  kfddlg i ge ad k a           i e   fma
 e       paa ae       ed      ad  d      e  a    ea  a                     a  

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
    .            :   :*  :      *:  :***   :   :                  : : : :       
vesvsrems---vlvgsiaawmTeylvshlreWiqsnGGWe-gfvdlf------ev--l----rswlltfatv-------
kklqnkkvrltgpekerlvyii taitrskhp lleq   vrrlrtkylnrwptr-rk-qgtwnrvvpsgsklsvsvgtr
 h keigqq   kcidq srf   nnn dn  dd     na lff gldaaaalgdggesigns mac hi       
    dh  e   e             id  a    a          a         ea eclf kr     g        

       250       260       270       280       290       300       310       320
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                          : :      : *                                          
--------------------------agvlwslfylwR------------------------------------------
glpaasfvpvwafcrllccrvspdggtdlkvlgssms kyyaapssgaerpskvsfpsessafpspsptggispgqglfq
                           aiglccal i gaa                                       
                             faa  f f e                                         

       330       340       350       360    
....:....|....:....|....:....|....:....|....
                                            
--------------------------------------------
rsmgrgcrgwgwaqgvagpgcgdhvdipacwggapgtasvgtwc
                                            
                                            
© 1998-2022Legal notice