Dataset for protein classical BH3-containing proteins of organism Equus asinus asinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
                        levmgftqstdedfesae llrpqrtgdlgae e        fprs gprsslsft
                            ar r  g   d v  ds dm l fi d           ah p  a aac  s
                                  e     d   a ag                   e g          

        90       100       110       120       130       140       150       160
lgqt -lpesaed-gqqalypghggqqsvmehplgpprl epte                           --pqrlfyg
acel  -------t-grpnlladrrpppsplga ag aw c pr                           sqvtmwtrr
       svprspmllnlkgrenilf  fl a      s   fa                           h rslrrhk
       aaf qladal gaecaec                                                 r     
           af     a     a                                                       

       170       180       190       200       210       220       230       240
        *                                              . .:                     
dkgyqlee gsqafrhy--am--mrqsqavpadmraapgvrgeenq-qhraelrygqqvqcmasqlqglhqqqaqqartr
nr-megdl splrgglp grspssapgaleggptq        -gl    savqv akiaglsawhhrrfmllvgmtqss
aar-dq q arm--eqh eeqv                     l--    pwrec is  acc p ls rsv-rlinkqp
  ksga   tlacs-    sp                       ty    lscpa h       k  f qnssncfghnf
   r      a   p                              p      ac          d    lkafh ee l 
   p                                                                  e    a    

       250       260       270       280       290       300       310       
ssvstwrlplnwawyvlvh             nggenspmmtsvvpsplwtrslqdwwlrpwprsvvmpvsvmgpaa
rrpq lpvgyrcpmr  p              gvdrarngleqrraggsrspaik kvdenvgngqsi sq      
hpll  lf hg lig                      q eg  n     plh        fl  ag a gd      
gcgf  h      a                         d   m                                 
© 1998-2023Legal notice