Dataset for protein Bad of organism Equus asinus asinus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MFQIPEFEQSEPEDSSPADRGLGPSPTGDWPSDPVRHQRTAPGLLGEAGHQQGQPASSSHHGGAGAVETRSRHSSYPEGT
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
**********************************************.                                 
EDEGMEGEEPGPFRGRSRSAPPNLWAALRYGRELRRMSDEFQGSFQvs--------------------------------
                                              alagaartpgpvlpghlplgcpirvpvhvgtdvs

       170       180       190       200       210  
....:....|....:....|....:....|....:....|....:....|..
       * *** *   .:  .*  :.       * :  . . *..      
-------PvPKSqGtltsvvqsPswtr-------RpvprsqsmPss------
gplpshg r   a magqmrpg lpshaiqswwd nlgeggga gqvvqtap
© 1998-2022Legal notice