Dataset for protein Noxa of organism Danio rerio

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40     
....:....|....:....|....:....|....:....|....:
*********************************************
MAKKEQTAVVECAQQLRNIGDLLNWKYKLLELIVTLQKIQMEGKR
© 1998-2023Legal notice