Dataset for protein classical BH3-containing proteins of organism Cebus capucinus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
 mecgpg adacmcqllcasssvwefakqegds--easalgdpfsaeqgsettgklrqtaecitartrwsrpassrqkpq
                   qcpd vtrqv-e--vd--mp rpler vppq naaahkpevdeahvlrmvrqw nkig la
                     mc  pmgrv-gqp psld qlgrk sacm aplraga q a gd mefglk  f   a 
                         hcemgp a  l    kka d l aa   d  d  l   a  gdeed   e     
                             c     a     h              a  g                    

        90       100       110       120       130       140       150       160
qymvptcwaqy-gds-hdkagn-e-n-h-e  g galekrlendmc ctspqeqrgh      yyeevpstffgllpsrv
psiskmls  te---d------w-lgwgv            yhriy a tspfe         rtlnmelsspv aglps
nreldlfn   cvrr vtdprhvp -r-n            r m s   ll d          hra lkanal      l
llaaad c   ara  qaaladr   ivd            a l m   de a          gm  e  k        e
            a      i a                                         f      e         

       170       180       190       200       210       220       230       240
apqrfwwwq ytrwwasmpapivdsfdglwhsltcdkhvsmpqptwqqvlll lnt lmgeenaeg  l         t 
qtdptqqqh rqkql pklqn qeqvk araqphvqtwsarknrssl   af h l                      l 
pa nlpeg  egegi  ifde a ga      k a saq naaaal                                  
   e faa  ae eg  e  c                                                           

r gevvnanlpgrlhallk
e edefd  fg  i    d
© 1998-2020Legal notice