Dataset for protein Bmf of organism Cebus capucinus imitator

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPSQCVEELEDDVFQPEDGEPGTQPGSLLSADLFAQSLLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
*****************. *  .  : *. *        *.:  ::.* * : .*                         
GVMLPCGVTEEPQRLFYgpAgyrsrvvAspPl-------PpqpqwqwRrEvqwgRpl-----------------------
                 an epklplp gf avlplgeq aeggfeh a qeia keqciadqfhqlhvqqhqqnrnrvw

       170       180    
....:....|....:....|....
                        
------------------------
wqvllflhnlalngeenrngaglr
© 1998-2020Legal notice