Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
--------------------------m-----veqsesdvsspadrepgpsp-----ps------------drp------
mplsvrsylwiwlgspgaglgdlapi-fqpqqmakqpqedfqee-ggl-tqqlsrlvtgllsadlfaqsqlec-lsrlql
                          repipef-el-d-----cr--grql-     raav cg cepglp--  aapa 
                           rrkrc-g-- -p egr- d - --      --            aa       
                           akad e s  e    l       f                             
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
        *                                                                       
--------Pglrp----ap-tlqeerqtqgpspmsssqgvtgpvpvtsrpssylygpasyrqtq--------avsaqppp
fplthccg qrskhwlt--tssgtdkhqrtqpag-phkstqtasgtrqehqrlrsamegnelslpaslppgrprgrstre
l aayl m tapa   gvtgl---agad-sla-apcdh-gml-cepceafnh-fa-h-dm-epeeedfgaflglpedas 
       a        a  a-  a----g---s- ---r--- ---------h--s-v--a---l gg tqarp vrge 
                    a   p wp   r r rgp pd  q sl paeq  e   ps pga         k      
                                                                                

       170       180       190       200       210       220       230   
....:....|....:....|....:....|....:....|....:....|....:....|....:....|...
             :*. :.*.::                           :   :                  
eqwaaq----igreLrrigDefnaly----------tqtyqrhrpswwrrllsylsrll-wrgg---------
nlvqhraeir-a-q qcma qlhvyhkglprrvsvrmaqvmqqsqrvtwqvqrwivnvvplnmqsnrsqagpr
gi irep vqy-ik    s k  rsf     pkfagh-a-egnpnmmllfiynl hkna gs deapngve n
tr p d   ec a       d  frq      err -e-r---------v vlf mg   rp trgape    
                                    q eq      p  k          f            
                                       e                                 
© 1998-2020Legal notice