Dataset for protein classical BH3-containing proteins of organism Bos taurus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
----------------------------------kqpsdvssecdreg--------------------------gqlqpg
mplsvrsylwiwlgspgaglgdlapimfqipema--------------lardgprpfplsrlvpsavscglmep--fpta
                          rrkkdqfemeeqecvepleddv                       ccacpsaae
                                  qsrpqd  rapvgl                       vr tl-mrp
                                  ra   g   e                               aph r
                                                                            e   
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                                
erppqlrp---gaptllqterq--------------------------------------------------------dr
dge-gtqarsllsagsfaqa--dcplprgqlfplthpcgpglrptsqepfatrsplfifvrrssllsrsssgyfsfdtsk
ra-a--skhwa---d-pgesqlqqgqselsrclqgscq  lap a pg                              gp
ac clvp-ayftrl-a----ghgn egawdgg rsr r  rpd                                   -h
    a -gcf c  wvrssvtaal a   p                                                a-
      c          pai                                                            
                 h                                                              

       170       180       190       200       210       220       230       240
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
                                                                        *. :.*.:
spatmscdkstqtpsppcqa-----------------------sgmasmrqsqavpadtrpeiwiAq----eLrrigDef
atqplppespsrgvmlsag-fnepqrlfyghagyrlplpahyl-a---ggp------------q--rrygaq qcma ql
qgslsavatrlessvyr--vte        n         sfpa-lpl---ppegqwqhpanl-w -eiark kals d 
h-g-g-a-qh--h---- aped                  neeteeldle trgrsrvrge e a  lt  r      k 
-s-q- -t--pa- eve  i                       p aea   f  a gsa                     
k   p   rv  d                                                                   
                                                                                

       250       260       270       280         
....:....|....:....|....:....|....:....|....:....
:                                                
nayy-rrvfvrhqaveghpqmvlwrvlrylvrlvwrmq-----------
hrlhp------mkraqqsr---wlqiwlniinvllnsdenrngagprsq
 vsfewkrqper-qyrtntnrm-sps yffhq-aapgrnlgrapsvppn
 ---m  gle prshgpa-alrqywp tralmgs lfpgglg geae  
 qrt    ra - -----ge ptr k vc asq  algtw l rrnl  
           s   pap    f        ak    aa          
                                                 
© 1998-2022Legal notice