Dataset for protein Bmf of organism Bos indicus

[Download (right click)] [Download Frequencies (right click)] [Sequences] [Alignment]

        10        20        30        40        50        60        70        80
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
********************************************************************************
MEPPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAQSQLDCPLSRLQLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
                                                                                

        90       100       110       120       130       140       150       160
....:....|....:....|....:....|....:....|....:....|....:....|....:....|....:....|
******************:*************************************************************
GVMLPCGVTEEPQRLFYGnAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEIQIARKLQCIADQFHRLHMQQYQQNRNRMW
                  h                                                             

       170       180    
....:....|....:....|....
************************
WQILLFLHNVALNGDENRNGAGPR
                        
© 1998-2020Legal notice