Dataset for protein BHRF1 of organism Lymphocryptovirus Macaca pfe lcl E3

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A0S0DHY9_BHRF1-01 BamHI-H right reading frame protein OS=[Viruses] Lymphocryptovirus Macaca/pfe-lcl-E3 GN=BHRF1 (length=191 residues).
MAFSTRDLLLALCMRDSHVHGNEGLHPVLELASRESPSSLSAGDTLVLRVHVLLEQIIEQNAGAFSEALDRFLSNTEAWD
VDFTRVFQEIFHRGNPTLGRALAWLAWCMHACRTLCCNRNTPYYVVDLSVRGMLEASEGLDAWIHQQGGWPSLLRGNRSG
TGSPGWTAFLAGLTLTLVVVCSYLFISGRRR
© 1998-2022Legal notice