Dataset for protein Unclassified of organism Oppiella nova

[Download (right click)]

2 sequence(s)

>gnl|bcl2dbpro|A0A7R9LYW1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Oppiella nova (length=300 residues).
MPFKRVCNVWVPVKGRWRGCSAVVLAIEWRIPESKECFAERSAQKEAIAAIAAKPMHTFSEYCNIWQFVATITSSTTTTT
SWRVHWYIPIECTIDIMATNGSSNVSEVRTNGHRMESSLQSIVNEFLCSQLALKGYNWTPEEVVPNGVNSDSHRTKIVDA
LKTLGHKYVNLYEEQLAAMCERLELSPSTAMTTFNSVSNELFIEGIKWHHIITFLVFGAEFAFNCVQNGFPNLVNEVSHW
ITTYVTQHLNPWIRDNGGWESVIELSDDKVVAGQKKLLYGAAGALGVLTLGLFLRNFSFK
>gnl|bcl2dbpro|A0A7R9QND1_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Oppiella nova (length=212 residues).
MATNGSSNVSEVRTNGHRMESSLQSIVNEFLSSQLALKGYNWTPEEVVPNGVNSDSHNQSFNLSERTKIVDALKTLGHKY
VNLYEEQLAAMCERLELSPSTAMTTFNSVSNELFIEGIKWHHIITFLVFSAEFAFNCVQNGFPNLVNEVSHWITTYVTQH
LHPWIRDNGGWESVIELSDDKVVAGQKKLLYGAAGALGVLTLGLFLRNFSFK
© 1998-2022Legal notice