Dataset for protein Bcl2l10 of organism Mesocricetus auratus

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A1U7QVA0_BCL2L10-01 BCL2-like 10 protein OS=[Eukaryota] Mesocricetus auratus GN=BCL2L10 (length=182 residues).
MADPLRVRTRLLLTDYLTFCAREPGDPEPPPTSAEAALLRSVAEQIQQQHHFFFSSFVGYQGNRVELMTQMVDAVLPDGQ
DLNWGRLVLLLAFAGTIVSQEQRNRLKDKMKVLQDCQLIVALLCNRLLRRHRSWLEAQGGWDGFCVIFGSPLPLDFWSTL
LIKTFLSCVIATAILFVWKRLL
© 1998-2020Legal notice