Dataset for protein Unclassified of organism Medioppia subpectinata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A7R9Q6U3_uncBCL2L1-02 Putative BCL2-like 1 protein OS=[Eukaryota] Medioppia subpectinata (length=217 residues).
MATNGSSNVSEVRTNGHNRTDCSLQSIVNEFLCSQLALKGYNWSPEVVANGVHNAADDSHNNQSFNSSQRTKIVDALKTL
GHKYVRLYEGQLSAMCERLELSPSTAMTTFNSVSNELFIEGIKWNHIITFLVFGSEFAFSCVQNGFPNLVNEVSHWITAY
VTTHLSQWIRDNGDWEYVIEFSGEKVVEGQKKLLYGAAGALGVLTLGLFLRNFSFFK
© 1998-2022Legal notice