Dataset for protein BCL-2-like of organism Lonchura striata domestica

[Download (right click)] [Alignment] [Repertoires]

6 sequence(s)

>gnl|bcl2dbpro|A0A218UQA0_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL-2 (length=237 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRVSLPPDHSASAAAAIAAAGTSDHTGLVSPHPEPPGSATASHTPP
AEGLRPAPQVVHLVLRQAGDEFSRRYQRDFSQMSGQLHLTPFTARSRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVESV
NREMFPLVDNIATWMTEYLNRHLHNWIQDNGGWDAFVELYGNNMRPLFDFSWISLKTILSLVLVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A218USB3_BCL2L1-04 BCL2-like 1 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL2L1 (length=230 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A218USB3_BCL2L1-02 BCL2-like 1 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL2L1 (length=240 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLSTRISISPLNASVCRWR
>gnl|bcl2dbpro|A0A218USB3_BCL2L1-03 BCL2-like 1 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL2L1 (length=230 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A218USB3_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL2L1 (length=248 residues).
MYSSNRELVIDFVSYKLSQKGYSWSQLEEEDENRTDFAGEEDEMDGVLNGSPSWHAATSHIVNGATVHQSSLEVHEIRRA
ADVRQALREAGDEFELRYRRAFSDLTSQLHITPSTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVVKEMRVLV
KRIVSWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEMRKGQETFNKWLLTGATVAGVLLLSTDSCCSCRTRSDPAWG
ARGLALAH
>gnl|bcl2dbpro|A0A218V8Z6_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Lonchura striata domestica GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRTMASSLQDQTEEAVRPLLDRIDISSVAVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTAEEKEEISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSRIT
ALFIALVSLFREYY
© 1998-2020Legal notice