Dataset for protein Bcl-2 of organism Larimichthys crocea

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A4D6FTA2_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Larimichthys crocea GN=BCL-2 (length=338 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEDMDVDRFKKMMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TAGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQDAFVELYDRQRDSVFSCSWPSIKTVFG
MAALGAASLTIGAYLTQK
>gnl|bcl2dbpro|A0A4D6FTA2_BCL2-02 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Larimichthys crocea GN=BCL-2 (length=359 residues).
MSSEEGLSSTVTDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGSHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEAKLLQAKKEVEKFAINDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEDM
DVDRFKKMMEVNYLGSVYPTRAVITTMKERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTV
AYPPDTDTPGLAEENKTKPLETKLISETAGVCQPDQVAKIIVRDAVQGNFNSSVGPDGYMLSALTCGMSPVTSITEGLQQ
IVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKTE
>gnl|bcl2dbpro|A0A4D6FTA2_BCL2-03 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Larimichthys crocea GN=BCL-2 (length=297 residues).
MLLVVAAFIVAFVLLLYMISPLISPKPLKLNGSHVVVTGGSSGIGKCIAIECYRQGAFITLVARDEAKLLQAKKEVEKFA
INDKQVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEDMDVDRFKKMMEVNYLGSVYPTRAVITTM
KERRMGRIMFVSSQAGQIGLFGYTAYSPSKFALRGLAESLQMEIKPYNIYVTVAYPPDTDTPGLAEENKTKPLETKLISE
TAGVCQPDQVAKIIVRDAIVTMGLFRTIALFYLGSFDSIVRRCMIQREQSKAADKTE
>gnl|bcl2dbpro|A0A4D6FTA2_BCL2-04 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Larimichthys crocea GN=BCL-2 (length=186 residues).
MSSEEGLSSTVTDWLFINSWWLLLPFIMLLVVAAFIVAFVLLLYMISPLISPKPLKLNGSHVVVTGGSSGIGKCIAIECY
RQGAFITLVARDEVVLCISVDVSSDYSQVESVIKQAQEKLGPVDMLVNCAGTSISGKFEDMDVDRFKIVTMGLFRTIALF
YLGSFDSIVRRCMIQREQSKAADKTE
>gnl|bcl2dbpro|A0A4D6FTA2_BCL2-05 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Larimichthys crocea GN=BCL-2 (length=228 residues).
MANERNRNIVEKYICHKLSKQGYVWGFDDVRDEDAANNGSIVAPPPTLVRRCREASTGPDTESIPHLCKRLPQSDPHAAI
HRVLREAGDELERLYQPDFTEMSRQLYLTSTTAQRRFAEVIDELFRDGVNWGRIIAFFEFGGTVCVECVAKEEMTPQVDN
IAEWMTEYLNGPLNSWIQDNGGWDAFVELYDRQRDSVFSCSWPSIKTVFGMAALGAASLTIGAYLTQK
© 1998-2022Legal notice