Dataset for protein Unclassified of organism Halisarca dujardini

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A6C0PP00_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Halisarca dujardini (length=223 residues).
MAGIPMANRVISGAVSGHYQTDTATLIVMKLVLEIVEDTEYQESVETVINKRTVASDIDSSANKDLIYVVVKKLRLLVEA
FQESQLPSLLEQCDRLNVTHANARTRYNLTVQQLFHDGVTWGRVVLFCAFSVGYLVHVVRRDMAHLSDSVIKWTVGVFKS
KLDPWIEQSGGWENFSAFADRVLAGSEGEQGSGLGGRLLAAAAVLGIAALAGLIVGRGGGGGH
© 1998-2020Legal notice