Dataset for protein BCL-2-like of organism Equus asinus asinus

[Download (right click)] [Alignment] [Repertoires]

5 sequence(s)

>gnl|bcl2dbpro|A0A8C4L1K6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Equus asinus asinus GN=BCL-2 (length=232 residues).
MAHAGRTGYDNREIVMKYIHYKLSQRGYEWDAGDAGAAPLGATPVPGIFSSQPGRTPAPARTSPLLPPAAPAGAAGPALS
PVPPVVHLTLRQAGDDFSRRYRRDFAEMSSQLHLTPFTARGRFATVVEELFRDGVNWGRIVAFFEFGGVMCVESVNREMS
PLVDNIALWMTEYLNRHLHTWIQDNGGWDAFVELYGPSMRPLFDFSWLSLKALLSLALVGACITLGAYLGHK
>gnl|bcl2dbpro|A0A8C4L244_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Equus asinus asinus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLAAGGGGASSPGGRLLAAGKEATARREGGGGEAGAVIGGSAGGSPQTTLAPDSLRVARPS
PIGAEGPDVTAPPSRLRFFAPTRCASPPEGMEAPAADAIMSPEEELDGYEPEPLGKRPAVLPLLEFVREASSGPCTDGSL
PSTPPPAEEEEDELYRQSLEIISRYLREQATGAKDTKPMGGSGAASRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMAHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A8C4L2X1_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Equus asinus asinus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYNWSQFSDVEENRTEAPEGTESEMETPSAINGNPSWHLADSPTGNGATGHSSSLDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
>gnl|bcl2dbpro|A0A8C4LWK5_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Equus asinus asinus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A8C4PQL1_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Equus asinus asinus GN=BCL2A1 (length=174 residues).
MTDCEFGYIHMLAQDYLKYVLQIPQPGSGPSKTSRVLQDIAFSVQNEVEKNLKPCLDNFHVVSIDAARTIFNQVMEKQFE
DGIINWGRIMTIFAFEGILIKKLLPERIAPDVDTYKEISYFVAEFITKNTGEWIRQNGGWENGFVKKFEPKSGWLTFLEV
TGKMCEILFLKQYY
© 1998-2022Legal notice