Dataset for protein Bfl1 of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5PYQ3_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2A1 (length=156 residues).
MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETEFEDGIINWG
RIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWGKWHSLMLMLVESVAQKKRKMAL
>gnl|bcl2dbpro|A0A2K5PYQ3_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Cebus capucinus imitator GN=BCL2A1 (length=168 residues).
MTDSEFGYIHNLTQDYLWYVLQIPQSGTGPSKTSRVLQKVAFSVQKPCLDNVNIVSIDNARTIFSQVMETEFEDGIINWG
RIVTIFAFEGILIKKLLQERIAPDVDTYKEISYFVAEYIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEM
LSLLKQYY
© 1998-2020Legal notice