Dataset for protein Unclassified of organism Bos indicus

[Download (right click)]

5 sequence(s)

>gnl|bcl2dbpro|A0A4W2CHX7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYNCSQFNDIWKPTPNAINDNPPWHLADSPVVNGATGHSRSLDAQKVIPMTTVKQTLRET
DNQFELRYQQTFSDLTSQLHITTGTAYQSFEQNGGWDSFVKLYENNTATKSQKGQDRSNHWSLMGMTLAGIALLGSLFTH
SNYSPHYNHSYFIQACVPLPFVIAIENLQFNKTLRFVTCIDYKMCTCLNSSVSLKNESLERGSHGRTCLSATH
>gnl|bcl2dbpro|A0A4W2E8M1_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQAVREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A0A4W2FHS8_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=173 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDMEENRTETPEGTESDMEIPSAINGNPSWHVADSPAVNGAIGHSRSLDARKM
IPMTTVKQALREASNEFELRYQQTFSDLTSQLHITPGTAYQSFEQENGDWDTFVELYENNTTESQKSQESFNCWSLMDVS
VAGVVPLGLLFNS
>gnl|bcl2dbpro|A0A4W2FL65_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=188 residues).
LESRKYFSCYIWKPTPNAINDNPPWHLADSPAVNGATGHSRSLDAQKVIPMTTVKQTLRETDNQFELRYQQTFSNLTSQL
HITTGTAYQSFEQVMYELFWAGVNWGHMAFFSFGGTLHRNQIPTWMATYLNDHLEPWIQENGGWDSFVKLYENNTATKSQ
KGQDRSNHWSLMGMTLAGIALLGSLFNS
>gnl|bcl2dbpro|A0A4W2H7Y7_uncBCL2L1-01 Putative BCL2-like 1 protein OS=[Eukaryota] Bos indicus (length=195 residues).
IFIMKMSQSNRRLVVDFLSYKLSQKGYSWSRFNDVEENRTEASEGTKSDMETPMPSMTTHLGTWRIAFSDQTSQLHITPG
TAYQSFEQMMYELLQDGVNWGRIVAFFSFGGALCMESIDKETQVLVSQSTTWMATYLNDHLESWIQENGGWDTSVKLCEN
NTTTESQKGQERFNSWSLTGMTSAGTALLGLLLNS
© 1998-2020Legal notice