Dataset for protein Mcl-1 of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A4W2CQV1_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=185 residues).
MCEEEEDELYWQSLEIISRYLREQATGAKDVKPLGRSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKS
LSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLE
GGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2D770_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=350 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLAAGKEATARREVGGGEAGTVIGGSAGPSPPATLAPDARRVARPSP
IGAEGPDVTATPTRLLFFAPTRLASPPEEMESPISDAIMSPEEELDGCEPDPLGKRPAVRPLPLLVGEASNNSPGSDGSL
PSTPPPAEEEEDELYRQSLEIISQYLREQATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDGFVEFFH
VEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2D770_MCL1-02 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=196 residues).
MFGLKRNAVIGLNLYCGGAGLGQGSGASSPGGRLLATGAKDAKPLGGSGTTSRKALETLRRVGDGVQRNHETAFQGMLRK
LDIKNEDDVKSLSRVMVHVFSDGVTNWGRIVTLISFGAFVAKHLKSINQESCIEPLAESITDVLVRSKRDWIVKQRGWDG
FVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
>gnl|bcl2dbpro|A0A4W2G6Q5_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Bos indicus GN=MCL-1 (length=185 residues).
MCEEEEDELYWQSLEIISRYLREQATGAKDVKPLGGSGATSRKALETLHRVGDGVQHNHETAFQGMLQKLDIKNEDDVKS
LSRVMVHVFSDRVTNWGRIVTLISFGAFVAKHFKSINQESCIEPLAESITDVLVRSKRDWIVKERGWDGFVEFFHVEDLE
GGIRNVLLAFAGVAGVGAGLAYLIR
© 1998-2020Legal notice