Dataset for protein Bcl-w of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

10 sequence(s)

>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=296 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGNQEEEEESGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
>gnl|bcl2dbpro|A0A4W2D6A3_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-03 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=323 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RSG
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-01 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=333 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWELEAIKARVREMEEEA
EKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPK
GFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVY
RGRARATSWYSPY
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-02 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=365 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWFSQTSEAEMVHEVFFG
EILSNCDSAPSSPVPEELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSIEEKMEADARSIYVGNVDY
GATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGF
PRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-05 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=336 residues).
MGTVLFSGHPLQGWKSSTSAWNVRDLLEMLNLLQGFMRPSRLLFTASRVRSPAWPLMPSWPCSSWPPAALFFPELWLFPS
LRPSPAPLSGRISGPHHHPAPGPPSRPPFLLPPSFPPFLPVSLPPSSCTRKQPDPGSGLTPARMATPASAPDTRALVADF
VGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLV
AFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEARRLREGNWASVRTVLTGA
VALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-06 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=193 residues).
MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAGDEFETRFRRTFSDLAAQLHVTPGSAQQRFT
QVSDELFQGGPNWGRLVAFFVFGAALCAESVNKEMEPLVGQVQEWMVAYLETRLADWIHSSGGWAEFTALYGDGALEEAR
RLREGNWASVRTVLTGAVALGALVTVGAFFASK
>gnl|bcl2dbpro|A0A4W2GUJ7_BCL2L2-04 BCL2-like 2 protein OS=[Eukaryota] Bos indicus GN=BCL2L2 (length=296 residues).
MAAAAAAAAAAGAAGGRGSGPGRRRHLVPGAGGEAGEGAPGGAGDYGNGLESEELEPEELLLEPEPEPEPEEEPPRPRAP
PGAPGPGPGSGAPGNQEEEEESGLVEGDPGDGAIEDPELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVI
MSIEEKMEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDKESVRTSLALDESLFRGR
QIKVIPKRTNRPGISTTDRGFPRARYRARTTNYNSSRSRFYSGFNSRPRGRVYRSG
© 1998-2020Legal notice