Dataset for protein Bcl-xL of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A4W2D608_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos indicus GN=BCL2L1 (length=238 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSGMKEHRTETPEGRESDMETPNSPTVNGATGHSRSLDARKMIPMTTVKQALRE
ASNEFKLWYQQTFSDLTSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTICMKSIDKEIHVLVSQVTTSMAT
YLNNHLKPWIQENGGWDTFVELYESNTTNESQKGQERFNSIYTTAAVAGLANLISNTKLYSKLDQRCPYYVGHSGSDR
>gnl|bcl2dbpro|A0A4W2F845_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos indicus GN=BCL2L1 (length=236 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSVRYGNPQWISGNPSWHLADSPTVNGATGHSRSLDARKMIPMTTVKQALREAS
NEFKLRYQQTFSDLMSQLRITPGTACQSFEQVINELFRDRVKWGHVVAFFSFSGTLCMKSIDKEIHVLVSQVTTSTATYL
NNHLKPWIQENGGWDTFVELYESNTTNESQKGQECFNSIYTTAAVAGLTNLISNTKLYSKLDQRCPYYVGHSGSDR
>gnl|bcl2dbpro|A0A4W2GX13_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Bos indicus GN=BCL2L1 (length=233 residues).
MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGTESDMETPSAINGNASWHLADSPAVNGATGHSRSSDAREV
IPMAAVKQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRIVAFFSFGGALCVESVDKEMQ
VLVSRIATWMATYLNDHLEPWIQENGGWDTFVELYGNNAAAESRKGQERFNRWFLTGMTVAGVVLLGSLFSRK
© 1998-2020Legal notice