Dataset for protein Bfl1 of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A4W2DYC0_BCL2A1-03 BCL2-related protein A1 protein OS=[Eukaryota] Bos indicus GN=BCL2A1 (length=175 residues).
MTDTEFGYVHGLAEDYLKYVLQIQQPGSKPSKTSRVLQDVASSVQDEVERTLKQCLDKFDVVSVDTARTIFNQVMEKEFE
DGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWENGFVKKFETKSGWLTFLEV
TGKICETLCRLKQYY
>gnl|bcl2dbpro|A0A4W2DYC0_BCL2A1-02 BCL2-related protein A1 protein OS=[Eukaryota] Bos indicus GN=BCL2A1 (length=201 residues).
MAAAVAVSGAKRSLRAELKQRLRALSAEERLRQSHLLAQKVFTHNEYQKSKRVSIFLSMPDEIETEEIIKDIFRQGKTCF
IPRYQLQSNHMDMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIFVPGLGFDKQSNRLGRGKGYYDAYLKR
CLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
>gnl|bcl2dbpro|A0A4W2DYC0_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Bos indicus GN=BCL2A1 (length=227 residues).
MEKEFEDGIVNWGRIVTIFAFEGILTKKLLGKCIASDMDMCKDISFFVAEFITENTGEWIKQNGGWVFTHNEYQKSKRVS
IFLSMPDEIETEEIIKDIFRQGKTCFIPRYQLQSNHMDMVKLASPEEIALLPRTSWNIQQPGEDEVLEEALSTGGLDLIF
VPGLGFDKQSNRLGRGKGYYDAYLKRCLQSQDVKPYTLALAFKEQICLQVPVNENDVKVDEVLYEDS
© 1998-2020Legal notice