Dataset for protein BCL-2-like of organism Anser cygnoid

[Download (right click)] [Alignment] [Repertoires]

4 sequence(s)

>gnl|bcl2dbpro|A0A8B9DB39_BCL2L1-01 BCL2-like 1 protein OS=[Eukaryota] Anser cygnoid GN=BCL2L1 (length=230 residues).
MSGSNRDLVIDFVSYKLSQKGYSWSQLEEEEDENRTDFAAEADTDGVLNGSPSWHPPASQVVNGAAVHRSSLEVHEIVRS
AAVRQALREAGDEFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGVNWGRVVAFFSFGGALCVESVDKEMRVLV
GRIVAWMTTYLTDHLDPWIQENGGWERFVDLYGNDAAAEVRKGQETFNKWLLTGATVAGVLLLGSLLSRK
>gnl|bcl2dbpro|A0A8B9E009_BCL2A1-01 BCL2-related protein A1 protein OS=[Eukaryota] Anser cygnoid GN=BCL2A1 (length=174 residues).
METAEFYYVYYLAQDYLQYVLQESHLGPAQTRVAHVLRNIASSLQDQTEEALRPFLDRIDITSVDVAKRIFNGVMDEKFA
DGNTNWGRIMTIFTFGGLLTKKLQEHGVQLTGEEKEQISYFITEYIINNKAEWIDANGGWENGFLTKFERRSLLSFSKIT
DIFVALFSLFREYY
>gnl|bcl2dbpro|A0A8B9E2U6_BCL2-01 B-cell CLL/lymphoma 2 protein OS=[Eukaryota] Anser cygnoid GN=BCL-2 (length=359 residues).
MAHPGRRGYDNREIVLKYIHYKLSQRGYDWAAGEDRAPAPTALAPAAAAVAAAGTPSRHRPAGLLSPHPEPPGSAAASEA
PPGEGLRPAPPVVHLALRQAGDEFSRRYQRDFAQMSGQLHLTPFTARGRFVAVVEELFRDGVNWGRIVAFFEFGGVMCVE
SVNREMSPLVDSIAAWMTEYLNRHLHNWIQDNGGWVRALRFAFLLRWPTALGALGCLWGSRVPTCAHLSVSVGTRGLPAA
SFVPVWAFCRLLCCRVSPDGGAAVKWCCFFLWRGAAAAPSSGAERPSKVSFPSESSAFPSPSPTGGISPGQGLFQRSMGR
GCRGWGWAQGVAGPGCGDHVDIPACWGGAPGTASVGTWC
>gnl|bcl2dbpro|A0A8B9EU67_MCL1-01 Myeloid cell leukemia sequence 1 protein OS=[Eukaryota] Anser cygnoid GN=MCL-1 (length=189 residues).
ALRSRRPPLAAVVEPRGGAGRLRTRNREGTRGGLDARDPPGAARRRKALETLRRVGDGVLEKHELAFQGMLRKLEIKKEE
DLQSVGEVAAHVFSDGVTNWGRVVTLISFGAFVAKHLKSIKQEKCIGSLARIITDALVSSKREWLLSQGGWEGFVDFFRV
EDLEGSIRNVLMAFAGVAGLGASLAYMIR
© 1998-2022Legal notice