Dataset for protein Bok of organism Cebus capucinus imitator

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A2K5QZM8_BOK-01 BCL2-related ovarian killer protein OS=[Eukaryota] Cebus capucinus imitator GN=BOK (length=212 residues).
MEVLRRSSVFAAEIMDAFDRSPTDKELVAQAKALGREFVHARLLRAGLSWSAPERAAPVPGRLAEVCAVLLRLGDELEMI
RPSIYRNVAHQLHISLQSEPVVTDAFLAVAGHIFSAGITWGKVVSLYAVAAGLAVDCVRQAQPAMVHALVDCLGEFVRKT
LATWLRRRGGWTDVLKCVVSTDPSLRSHWLLTALCSFGRFLKAAFFVLLPER
© 1998-2020Legal notice