Dataset for protein Unclassified of organism Stella vacuolata

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A4P2YI52_uncBBC3-01 Putative BCL2 binding component 3 protein OS=[Bacteria] Stella vacuolata (length=541 residues).
MEKLRIALDIFGGLGLFFIGMRLLSTHLKDTAGNRVRLFAARVARRRSLMMLVGTSAGIATQSTNAVTAAATGLATAHIL
SIREAFPLIACANIGTSLLVYLAAVDLHLEVLFAAGVCGVLYYLKFDQSPRHRAPIGALLALTLILFGLDLIGQGAVGLR
GDPELQAIFGLLSGMPVAAFVVGAALVPVLQTAKTVAVVVALLAQSGVLGPVEAIAAVIGANLTSAANVAALTSGVSPMG
RALGYYQAILKFIGSVLAIIALLVTLAVSPGLFAGIDPANAPYLVATAYLIMQTAAYAVSMAFEGPISARLTHMVQRRTR
DDPNEPRYISREALNDPATATELAFKEHLDIMAGLSAELDEVRQDRPAETMPRRDGAAIGRALAEFLDALSGQTNDEAVR
RRVGSLRRLHNLAMAMHPLIRGLAANAARSGSDSEVVQPMEMMVESAHMLLDLFGSACQSGDAEDRLQVLELTSDRTPVT
EQIRLAVMSRQAADAEGARTLFDSCIAFERIIWLIRRYLLLTDEPGSPYRDDGSPSAAAGN
© 1998-2020Legal notice