Dataset for protein Bmf of organism Salmo salar

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A1S3P5K4_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo salar GN=BMF (length=194 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNQQPQQPARSIEICIGQKLQLIGDQFHQEHVQVVRIPNVTDCTAQLKPTEQAYCTQRSAERETEQQKWLLYG
HPLCSRLSVPCLFWLVSEHALAQCSDLSFYPPKT
>gnl|bcl2dbpro|A0A1S3P5K4_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Salmo salar GN=BMF (length=159 residues).
MDDEEDDVFEPDSHCWRTAFREIKYEDRGTQTPSPVLPLPNNMLPCGVAQEPRPLFYGNAGFRLHFPAQFERVGDQGPLG
ERGGMERLNQQPQQPARSIEICIGQKLQLIGDQFHQEHVQVYHRNQRNMRPLWRRLASALLTLLFEQEAIAGGERAGWR
>gnl|bcl2dbpro|A0A1S3SNN2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Salmo salar GN=BMF (length=161 residues).
MDDEEDDVFVPDSSHCWRTAFREIKYEDRGTQTPSPALALPNDMLPCGVAQEPRPLFYGNAGFRLHFPARFEQVGDQGPQ
EQHQGERGRMERLQQQPAQSMEVCIGQKLQLIGDQFYQEHLQLYHRNQRNMRPMWWRLASALFTLLFEQEAIAGRGRAGW
R
© 1998-2020Legal notice