Dataset for protein Bik of organism Heterocephalus glaber

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|G5BM80_BIK-01 BCL2-interacting killer protein OS=[Eukaryota] Heterocephalus glaber GN=BIK (length=186 residues).
MSEARPVTRDLLMETLLYEPLPGPLLATGALAVMHPFRGEDLSPPGDTDLVGCLEGSSLMALRLACIGDEMDLRLRAPRL
AQLPGRAVHSLAITYSQMGLWGVLRSLTPGLTSLRDMWPWGHLAPHAWVSPGWACRQLLPVVLLVLLLGILRLLLQGGPA
GRQGWSLSPLPPLPPGGPPPGQLCSF
© 1998-2020Legal notice