Dataset for protein Bmf of organism Equus asinus asinus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A8C4MCB2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Equus asinus asinus GN=BMF (length=184 residues).
MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQHQQNRNRVW
WQTLLFLHNLALNGDENRNGAGPR
>gnl|bcl2dbpro|A0A8C4MCB2_BMF-02 Bcl2 modifying factor protein OS=[Eukaryota] Equus asinus asinus GN=BMF (length=202 residues).
MESPQCVEELEDDVFQPEDGEPGTQPRSLLSADLFAPSQLDCPLSHLRLFPLTHCCGPGLRPTSQEDKATQTLSPASPSQ
GVMLPCGVTEEPQRLFYGNAGYRLPLPASFPAGLPLGEQPPEGQWQHRAEVQIARKLQCIADQFHRLHMQQVGMGAWGGG
ESSGDGGPGPASGLRLPSLKDKVLEFWPNAVVIPVDWMGPTA
© 1998-2022Legal notice