Dataset for protein Bad of organism Cebus capucinus imitator

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A2K5PDB1_BAD-01 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cebus capucinus imitator GN=BAD (length=167 residues).
MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGGAGAVETRSRHRSYPAGT
EEDEGMEEEPSTFRGRSRSAPPNLWAAQRYGRELRRMSDEFVDSFKGLPRPKSAGTATQMRQSASWTRVIQSWWDRNLGR
GGSAPSQ
>gnl|bcl2dbpro|A0A2K5PDB1_BAD-03 BCL2-associated agonist of cell death protein OS=[Eukaryota] Cebus capucinus imitator GN=BAD (length=149 residues).
MFQIPEFEPSEQEGSSSAERGLNPSTAGDSPPGSGKHRRQAPGLPGDASHQQGQPTSSSHHGENPSARMLSKTSAGMSSP
ATDSEAQHTENVKLEALGLWRPGVATDRTPQGRRRTKGWRRSPAPFGAVRARHPPTSGQHSAMAASSGG
© 1998-2020Legal notice