Dataset for protein Bim of organism Bos taurus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A3Q1MV27_BCL2L11-03 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=139 residues).
MAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPMSCDKSTQTPSPPCQAFNHYLSAMASMRQSQAV
PADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVLRYIVRLVWRMQ
>gnl|bcl2dbpro|A0A3Q1MV27_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Bos taurus GN=BCL2L11 (length=171 residues).
MPLSVRSYLWIWLGSPGAGLGDLAPIRRKKDQMAKQPSDVSSECDREGGQLQPAERPPQLRPGAPTSLQTERQDRSPAPM
SCDKSTQTPSPPCQAFNHYLSAMASMRQSQAVPADTRPEIWIAQELRRIGDEFNAYYPRRVFVRHQAVEGHPQMVLLRVL
RYIVRLVWRMQ
© 1998-2020Legal notice