Dataset for protein Hrk of organism Bos indicus

[Download (right click)] [Alignment] [Repertoires]

2 sequence(s)

>gnl|bcl2dbpro|A0A4W2CRW4_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Bos indicus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPASGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
>gnl|bcl2dbpro|A0A4W2GVZ3_HRK-01 Harakiri, BCL2 interacting protein protein OS=[Eukaryota] Bos indicus GN=HRK (length=91 residues).
MCPCPLHRGRGPPAVCACSAGRLGLRSSAAQLTAARLKALGDELHQRTMWRRRARSRRAPAPGALPTYWPWLCAAAQVAA
LAAWLLGRRNL
© 1998-2020Legal notice