Dataset for protein Noxa of organism Anser cygnoid

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9EN35_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anser cygnoid GN=PMAIP1 (length=44 residues).
LPGAHPPQRDAVAECALELRRIGDKADLRQRILNLIAKLFCPKT
© 1998-2022Legal notice