Dataset for protein classical BH3-containing proteins of organism Anser cygnoid

[Download (right click)] [Alignment] [Repertoires]

3 sequence(s)

>gnl|bcl2dbpro|A0A8B9EN35_PMAIP1-01 Phorbol-12-myristate-13-acetate-induced protein 1 protein OS=[Eukaryota] Anser cygnoid GN=PMAIP1 (length=44 residues).
LPGAHPPQRDAVAECALELRRIGDKADLRQRILNLIAKLFCPKT
>gnl|bcl2dbpro|A0A8B9EP68_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anser cygnoid GN=BCL2L11 (length=144 residues).
MKPCQPPPGPSRPAARRGRSRRPPAPARSPPARRSSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWR
SHLLAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLIVILRLLHYIIRLIWRMQ
>gnl|bcl2dbpro|A0A8B9EVW2_BMF-01 Bcl2 modifying factor protein OS=[Eukaryota] Anser cygnoid GN=BMF (length=193 residues).
MDRPSYLEEDYSSLDGLDDDVFHSDDFGLAGQPGEMTATGIFTQNQSYSCLLGRFQLFPLTHCCGPGVRHPEQQDKATQT
LSPSSSSQDVMLPCGVTEEPRRLFYGNAGYRLHVPPVGFALDPHLQEEPQEGQQEARAEVQIARKLQCIADQFHRLHIQR
HQQNRNQVWWQLFLFLHNLALNVEANRNHTGQR
© 1998-2022Legal notice