Dataset for protein Bim of organism Anser cygnoid

[Download (right click)]

1 sequence(s)

>gnl|bcl2dbpro|A0A8B9EP68_BCL2L11-01 BCL2-like 11 protein OS=[Eukaryota] Anser cygnoid GN=BCL2L11 (length=144 residues).
MKPCQPPPGPSRPAARRGRSRRPPAPARSPPARRSSSSGYFSFEAERSPAPMSCDKATQTPSPPCQAVSHYLSAMASRWR
SHLLAEEIQPEIWIAQELRRIGDEFNASYCPRRVIFLFLLSISLHLIVILRLLHYIIRLIWRMQ
© 1998-2022Legal notice