Dataset for protein BCL-2-like of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

4 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7QVA0_BCL2L10      MADPLRVR-TRLLLTDYLTFCARE--------------------------
A0A1U7RC37_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGY-----------------------
A0A1U7QU73_BCL2L1-      -----MSQSNRELVVDFLSYKLSQKGYSWSQFSDVEENRTEAPEGAESER
A0A1U7RC37_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGY-----------------------
                                 .* *:.*:: :   :                          

A0A1U7QVA0_BCL2L10      ---------------------PGDPEPPPTS--------AEAALLRSVAE
A0A1U7RC37_BCL2L2-      ------------------VCGAGPGEGPAAD--------PLHQAMRAAGD
A0A1U7QU73_BCL2L1-      ETPSAINGNPSWHLADSPAVNGATGHSSSLDAREVIPMAAVKQALREAGD
A0A1U7RC37_BCL2L2-      ------------------VCGAGPGEGPAAD--------PLHQAMRAAGD
                                              .    .. .        .    :* ..:

A0A1U7QVA0_BCL2L10      QIQQQHHFFFSSFVG----YQGNRVELMTQMVDAVLPDGQDLNWGRLVLL
A0A1U7RC37_BCL2L2-      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAF
A0A1U7QU73_BCL2L1-      EFELRYRRAFSDLTSQLHITPGTAYQSFEQVVNELFRDGV--NWGRIVAF
A0A1U7RC37_BCL2L2-      EFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGP--NWGRLVAF
                        ::: ...  **.:..      *.  : : *: : :: .*   ****:* :

A0A1U7QVA0_BCL2L10      LAFAGTIVSQEQRNRLKDKMKVLQDCQLIVALLCNRLLRRHRSWLEAQGG
A0A1U7RC37_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQD------WMVTYLETRLADWIHSSGG
A0A1U7QU73_BCL2L1-      FSFGGALCVESVDKEMQVLVSRIAS------WMATYLNDHLEPWIQDNGG
A0A1U7RC37_BCL2L2-      FVFGAALCAESVNKEMEPLVGQVQD------WMVTYLETRLADWIHSSGG
                        : *..::  :.  : ::  :  : .       : . *  .   *:  .**

A0A1U7QVA0_BCL2L10      WD------------------------------------------------
A0A1U7RC37_BCL2L2-      WA------------------------------------------------
A0A1U7QU73_BCL2L1-      WD------------------------------------------------
A0A1U7RC37_BCL2L2-      WELEAIKARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEK
                        *                                                 

A0A1U7QVA0_BCL2L10      -------------------------------------------------G
A0A1U7RC37_BCL2L2-      -------------------------------------------------E
A0A1U7QU73_BCL2L1-      -------------------------------------------------T
A0A1U7RC37_BCL2L2-      MEADARSIYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFA
                                                                          

A0A1U7QVA0_BCL2L10      FCVIFGS-------PLPLDFWSTLLIKTFL--------------------
A0A1U7RC37_BCL2L2-      FTALYGDGALEEARRLREGNWAS--VRTVL--------------------
A0A1U7QU73_BCL2L1-      FVELYGNNAAAES---------------------RKGQERFNRWF-----
A0A1U7RC37_BCL2L2-      YIEFSDKESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARY
                        :  : ..                                           

A0A1U7QVA0_BCL2L10      ---------------------SCVIATAILFVWKRLL---
A0A1U7RC37_BCL2L2-      ---------------------TGAVALGALVTVGAFFASK
A0A1U7QU73_BCL2L1-      ---------------------LTGMTVAGVVLLGSLFSRK
A0A1U7RC37_BCL2L2-      RARTTNYNSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                                 .              

© 1998-2020Legal notice