Dataset for protein Bcl-w of organism Mesocricetus auratus

[Download (right click)] [Edit] [Sequences] [Repertoires]

2 sequence(s)

CLUSTAL W (1.81) multiple sequence alignment


A0A1U7RC37_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
A0A1U7RC37_BCL2L2-      MATPASAPDTRALVADFVGYKLRQKGYVCGAGPGEGPAADPLHQAMRAAG
                        **************************************************

A0A1U7RC37_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
A0A1U7RC37_BCL2L2-      DEFETRFRRTFSDLAAQLHVTPGSAQQRFTQVSDELFQGGPNWGRLVAFF
                        **************************************************

A0A1U7RC37_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWA-EFTA
A0A1U7RC37_BCL2L2-      VFGAALCAESVNKEMEPLVGQVQDWMVTYLETRLADWIHSSGGWELEAIK
                        ********************************************  *   

A0A1U7RC37_BCL2L2-      LYGDGALEEARRLRE---------------GNWASV------------RT
A0A1U7RC37_BCL2L2-      ARVREMEEEAEKLKELQNEVEKQMNMSPPPGNAGPVIMSLEEKMEADARS
                               *** .*.*               ** ..*            *:

A0A1U7RC37_BCL2L2-      VLTGAVALGALVT-------------------------------------
A0A1U7RC37_BCL2L2-      IYVGNVDYGATAEELEAHFHGCGSVNRVTILCDKFSGHPKGFAYIEFSDK
                        : .* *  ** .                                      

A0A1U7RC37_BCL2L2-      --------------------------------------------------
A0A1U7RC37_BCL2L2-      ESVRTSLALDESLFRGRQIKVIPKRTNRPGISTTDRGFPRARYRARTTNY
                                                                          

A0A1U7RC37_BCL2L2-      -------------------------VGAFFASK
A0A1U7RC37_BCL2L2-      NSSRSRFYSGFNSRPRGRVYRGRARATSWYSPY
                                                 . ::::. 

© 1998-2020Legal notice